PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.003G200100.2
Common NamePHAVU_003G200100g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB
Protein Properties Length: 196aa    MW: 22483.3 Da    PI: 8.2218
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.003G200100.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.23e-161057148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W +eEd  l +++k++G+g W++I+r  g++R++k+c++rw +yl
  Phvul.003G200100.2 10 KGFWNAEEDSVLTNYIKKHGTGKWNRIPRVTGLKRSGKSCRLRWMNYL 57
                        688*******************************************97 PP

2Myb_DNA-binding53.94.2e-1763108148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         rg +++eE++l ++++ +lG++ W++Ia +++ gRt++q+k++w+++l
  Phvul.003G200100.2  63 RGDFSEEEEDLVLRLHSLLGNR-WSLIAGRIP-GRTDNQVKNFWNTHL 108
                         899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.945557IPR017930Myb domain
SuperFamilySSF466891.17E-298104IPR009057Homeodomain-like
SMARTSM007174.8E-13959IPR001005SANT/Myb domain
PfamPF002493.2E-131157IPR001005SANT/Myb domain
CDDcd001671.92E-101357No hitNo description
Gene3DG3DSA:1.10.10.602.8E-211364IPR009057Homeodomain-like
PROSITE profilePS5129426.75458112IPR017930Myb domain
SMARTSM007172.8E-1662110IPR001005SANT/Myb domain
PfamPF002493.8E-1663108IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2565112IPR009057Homeodomain-like
CDDcd001671.18E-1166108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048765Biological Processroot hair cell differentiation
GO:0090377Biological Processseed trichome initiation
GO:0090378Biological Processseed trichome elongation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MEAYENESKK GFWNAEEDSV LTNYIKKHGT GKWNRIPRVT GLKRSGKSCR LRWMNYLTPD  60
VKRGDFSEEE EDLVLRLHSL LGNRWSLIAG RIPGRTDNQV KNFWNTHLSK KIGVDNKKRR  120
RGCVRAKYVP RAEAEGNCNT GEGDKLVDES WSDDLMELAS MHEAIMRDDF GCTFSFPNAV  180
FDLCTDSFHH SFFGL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-27101127108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150345e-56AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007155422.11e-145hypothetical protein PHAVU_003G200100g
RefseqXP_007155423.11e-145hypothetical protein PHAVU_003G200100g
SwissprotQ9SEI05e-60WER_ARATH; Transcription factor WER
TrEMBLV7CB521e-145V7CB52_PHAVU; Uncharacterized protein
STRINGVIT_17s0000g08480.t013e-59(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.13e-61myb domain protein 66